« Back
Home /
Anti-Neuroserpin Picoband Antibody

Anti-Neuroserpin Picoband Antibody

Item no.	ABC-ABO12430
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	Neuroserpin, SERPINI1, PI12, Peptidase inhibitor 12, PI-12, Serpin I1
Available
Primary Accession	Q99574
Application	WB
Clonality	Polyclonal
Gene ID	5274
Reactivity	H, M, Rat
Legend image 1	Anti-Neuroserpin Picoband antibody, ABO12430, Western blottingAll lanes: Anti Neuroserpin (ABO12430) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: PANC Whole Cell Lysate at 40ugPredicted bind size: 46KDObserved bind size: 46KD
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	46427
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Neuroserpin(SERPINI1) detection. Tested with WB in Human; Mouse; Rat.
Protein Function	Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator.
Subcellular Localization	Secreted.
Tissue Specificity	Predominantly expressed in the brain.
Protein Name	Neuroserpin
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino aci
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins.
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO12430-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/8/2024

Express Delivery: Save 31 days

Compare

Add to wishlist

Recommend by mail