Item no. |
ABC-ABO12430 |
Manufacturer |
Abcepta
|
Amount |
100 ug |
Category |
|
Type |
Antibody Primary |
Format |
Lyophilized |
Applications |
WB |
Specific against |
other |
Host |
Rabbit |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Similar products |
Neuroserpin, SERPINI1, PI12, Peptidase inhibitor 12, PI-12, Serpin I1 |
Available |
|
Primary Accession |
Q99574 |
Application |
WB |
Clonality |
Polyclonal |
Gene ID |
5274 |
Reactivity |
H, M, Rat |
Legend image 1 |
Anti-Neuroserpin Picoband antibody, ABO12430, Western blottingAll lanes: Anti Neuroserpin (ABO12430) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: PANC Whole Cell Lysate at 40ugPredicted bind size: 46KDObserved bind size: 46KD |
Type image 1 |
WB |
Dilution image 1 |
0.1-0.5 µg/ml |
Calculated MW |
46427 |
Reconstitution |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Description |
Rabbit IgG polyclonal antibody for Neuroserpin(SERPINI1) detection. Tested with WB in Human; Mouse; Rat. |
Protein Function |
Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator. |
Subcellular Localization |
Secreted. |
Tissue Specificity |
Predominantly expressed in the brain. |
Protein Name |
Neuroserpin |
Contents |
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino aci |
Purification |
Immunogen affinity purified. |
Cross Reactivity |
No cross reactivity with other proteins. |
Storage |
At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing. |
Concentration (mg/ml) |
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.