« Back
Home /
Anti-IGFBP-3 Antibody

Anti-IGFBP-3 Antibody

Item no.	ABC-ABO12396
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB, ELISA, IHC-P
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	IGFBP3, IGF-binding protein 3, IGFBP-3, IBP3, Insulin-like growth factor-binding protein 3, IBP-3
Available
Primary Accession	P17936
Application	WB, IHC-P, E
Clonality	Polyclonal
Gene ID	3486
Reactivity	H, Rat
Legend image 1	Anti- IGFBP-3 Picoband antibody, ABO12396, Western blottingAll lanes: Anti IGFBP-3 (ABO12396) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: SGC Whole Cell Lysate at 40ugLane 4: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Legend image 2	Anti- IGFBP-3 Picoband antibody, ABO12396, IHC(P)IHC(P): Human Intestinal Cancer Tissue
Type image 2	IHC
Dilution image 2	0.5-1 µg/ml
Calculated MW	31674
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human; Rat.
Protein Function	IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R. .
Subcellular Localization	Secreted .
Tissue Specificity	Expressed by most tissues. Present in plasma.
Protein Name	Insulin-like growth factor-binding protein 3
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO12396-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/6/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail