« Back
Home /
Anti-IRF5 Picoband Antibody

Anti-IRF5 Picoband Antibody

Item no.	ABC-ABO12332
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB, IHC-P
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	IRF5, IRF-5, Interferon regulatory factor 5
Available
Primary Accession	Q13568
Application	WB, IHC-P
Clonality	Polyclonal
Gene ID	3663
Reactivity	H, M, Rat
Legend image 1	Anti- IRF5 Picoband antibody, ABO12332, Western blottingAll lanes: Anti IRF5 (ABO12332) at 0.5ug/mlLane 1: Rat Intestine Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: NIH3T3 Whole Cell Lysate at 40ugLane 5: HEPA Whole Cell Lysate at 40ugPredicted bind size: 56KDObserved bind size: 56KD
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Legend image 2	Anti- IRF5 Picoband antibody, ABO12332, IHC(P)IHC(P): Mouse Spleen Tissue
Type image 2	IHC
Dilution image 2	0.5-1 µg/ml
Legend image 3	Anti- IRF5 Picoband antibody, ABO12332, IHC(P)IHC(P): Rat Spleen Tissue
Type image 3	IHC
Legend image 4	Anti- IRF5 Picoband antibody, ABO12332, IHC(P)IHC(P): Human Mammary Cancer Tissue
Type image 4	IHC
Calculated MW	56044
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Interferon regulatory factor 5(IRF5) detection. Tested with WB, IHC-P in Human; Mouse; Rat.
Protein Function	Transcription factor involved in the induction of interferons IFNA and INFB and inflammatory cytokines upon virus infection. Activated by TLR7 or TLR8 signaling. .
Subcellular Localization	Cytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm.
Protein Name	Interferon regulatory factor 5
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human IRF5 (442-472aa RLQISNPDLKDRMVEQFKELHHIWQSQQRLQ), different from the related mouse sequence by three amino acids.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO12332-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/6/2024