« Back
Home /
Anti-ICA1 Picoband Antibody

Anti-ICA1 Picoband Antibody

Item no.	ABC-ABO12183
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	ICA1, Islet cell autoantigen 1, 69 kDa islet cell autoantigen, Islet cell autoantigen p69, ICA69, ICAp69, p69
Available
Primary Accession	Q05084
Application	WB
Clonality	Polyclonal
Gene ID	3382
Reactivity	H, M, Rat
Legend image 1	Anti- ICA1 Picoband antibody, ABO12183, Western blottingAll lanes: Anti ICA1 (ABO12183) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Pancreas Tissue Lysate at 50ugPredicted bind size: 55KDObserved bind size: 55KD
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	54645
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Islet cell autoantigen 1(ICA1) detection. Tested with WB in Human; Mouse; Rat.
Protein Function	May play a role in neurotransmitter secretion. .
Subcellular Localization	Cytoplasm, cytosol . Golgi apparatus membrane ; Peripheral membrane protein . Cytoplasmic vesicle, secretory vesicle membrane ; Peripheral membrane protein . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Peripheral membrane protein . Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules.
Tissue Specificity	Expressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
Protein Name	Islet cell autoantigen 1
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK), identical to the related mouse and rat sequences.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO12183-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/4/2024

Express Delivery: Save 24 days

Compare

Add to wishlist

Recommend by mail