« Back
Home /
Anti-PSMA2 Picoband Antibody

Anti-PSMA2 Picoband Antibody

Item no.	ABC-ABO11706
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	PSMA2, HC3, PSC3, Macropain subunit C3, Proteasome component C3, Proteasome subunit alpha type-2, Multicatalytic endopeptidase complex subunit C3, 3.4.25.1
Available
Primary Accession	P25787
Application	WB
Clonality	Polyclonal
Gene ID	5683
Reactivity	H, Rat
Legend image 1	Western blot analysis of PSMA2 expression in rat testis extract (lane 1) and MCF-7 whole cell lysates (lane 2). PSMA2 at 26KD was detected using rabbit anti- PSMA2 Antigen Affinity purified polyclonal antibody (Catalog # ABO11706) at 0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	25899
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-2(PSMA2) detection. Tested with WB in Human; Rat.
Protein Function	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component(s) of the proteasome complex through tyrosine phosphorylation.
Subcellular Localization	Cytoplasm. Nucleus. Cytoplasm, P-body . Colocalizes with TRIM5 in the cytoplasmic bodies. .
Protein Name	Proteasome subunit alpha type-2
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYT Q), identical to the related mouse and rat sequences.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins.
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO11706-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 9/6/2024

Express Delivery: Save 7 days

Compare

Add to wishlist

Recommend by mail