« Back
Home /
Anti-Peptide YY Picoband Antibody

Anti-Peptide YY Picoband Antibody

Item no.	ABC-ABO11632
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	Peptide YY, Pyy
Available
Primary Accession	Q9EPS2
Application	WB
Clonality	Polyclonal
Gene ID	217212
Reactivity	M
Legend image 1	Western blot analysis of Peptide YY expression in mouse spleen extract (lane 1) and mouse liver extract (lane 2). Peptide YY at 19KD was detected using rabbit anti- Peptide YY Antigen Affinity purified polyclonal antibody (Catalog # ABO11632) at 0.5 ??g/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	11064
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Peptide YY(PYY) detection. Tested with WB in Mouse.
Protein Function	This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Subcellular Localization	Secreted.
Protein Name	Peptide YY
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO11632-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/8/2024

Express Delivery: Save 29 days

Compare

Add to wishlist

Recommend by mail