« Back
Home /
Anti-Annexin VII Picoband Antibody

Anti-Annexin VII Picoband Antibody

Item no.	ABC-ABO10312
Manufacturer	Abcepta
Amount	100 ug
Category	Antibodies Primary Antibodies
Type	Antibody Primary
Format	Lyophilized
Applications	WB
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	ANXA7, Annexin A7, ANX7, SNX, Annexin VII, Annexin-7, Synexin
Available
Primary Accession	P20073
Application	WB
Clonality	Polyclonal
Gene ID	310
Reactivity	H
Legend image 1	Western blot analysis of Annexin VII expression in JURKAT whole cell lysates (lane 1). Annexin VII at 52KD was detected using rabbit anti- Annexin VII Antigen Affinity purified polyclonal antibody (Catalog # ABO10312) at 0.5 Î¼g/mL. The blot was developed using chemiluminescence (ECL) method .
Type image 1	WB
Dilution image 1	0.1-0.5 µg/ml
Calculated MW	52739
Reconstitution	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description	Rabbit IgG polyclonal antibody for Annexin A7(ANXA7) detection. Tested with WB in Human.
Protein Function	Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Tissue Specificity	Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. .
Protein Name	Annexin A7
Contents	Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid.
Purification	Immunogen affinity purified.
Cross Reactivity	No cross reactivity with other proteins.
Storage	At -20?C for one year. After r?Constitution, at 4?C for one month. It?Can also be aliquotted and stored frozen at -20?C for a longer time.Avoid repeated freezing and thawing.
Concentration (mg/ml)	Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

ABC-ABO10312-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/4/2024

Express Delivery: Save 15 days

Compare

Add to wishlist

Recommend by mail