« Back
Home /
LIN28B Rabbit mAb

LIN28B Rabbit mAb

Item no.	A9524-200ul
Manufacturer	Abclonal
Amount	200ul
Category	Antibodies Western Blot Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVAN
NCBI	LIN28B
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CSDD2
Similar products	CSDD2
Available
Background	The protein encoded by this gene belongs to the lin-28 family, which is characterized by the presence of a cold-shock domain and a pair of CCHC zinc finger domains. This gene is highly expressed in testis, fetal liver, placenta, and in primary human tumors and cancer cell lines. It is negatively regulated by microRNAs that target sites in the 3' UTR, and overexpression of this gene in primary tumors is linked to the repression of let-7 family of microRNAs and derepression of let-7 targets, which facilitates cellular transformation.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human LIN28B (Q6ZN17).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200
Protein Size	27kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Cancer, Tumor biomarkers
Gene Symbol	LIN28B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 18 days

Compare

Add to wishlist

Recommend by mail