« Back
Home /
Calpain 1 Rabbit mAb

Calpain 1 Rabbit mAb

Item no.	A8710-50ul
Manufacturer	Abclonal
Amount	50ul
Category	Antibodies Cell Biology Cell Status Apoptosis Western Blot Immunofluorescence Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	DGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNG
NCBI	CAPN1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CANP, CANP1, CANPL1, SPG76, muCANP, muCL
Similar products	CANP, CANP1, CANPL1, muCANP, muCL, SPG76
Available
Background	The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
Route	Synthetic Peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 -1:1000\|IF/ICC, 1:50 -1:200
Protein Size	82kDa
Manufacturers Research Area	Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Ubiquitin, Immunology Inflammation, T Cell Receptor Signaling Pathway, Neuroscience, Calcium Signaling, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease
Gene Symbol	CAPN1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 31 days

Compare

Add to wishlist

Recommend by mail