« Back
Home /
PDE5A Rabbit pAb

PDE5A Rabbit pAb

Item no.	A6831-500uL
Manufacturer	Abclonal
Amount	500 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCS
NCBI	PDE5A
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	PDE5A;CGB-PDE;CN5A;PDE5
Available
Background	This gene encodes a cGMP-binding, cGMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family. This phosphodiesterase specifically hydrolyzes cGMP to 5'-GMP. It is involved in the regulation of intracellular concentrations of cyclic nucleotides and is important for smooth muscle relaxation in the cardiovascular system. Alternative splicing of this gene results in three transcript variants encoding distinct isoforms.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PDE5A (NP_001074.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	100kDa
Manufacturers Research Area	Cancer, Signal Transduction, Cell Biology Developmental Biology, Endocrine Metabolism, Cardiovascular, Hypoxia, Heart, Hypertrophy, Cardiovascular diseases, Heart disease
Gene Symbol	PDE5A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 17 days

Compare

Add to wishlist

Recommend by mail