« Back
Home /
DCP1A Rabbit mAb

DCP1A Rabbit mAb

Item no.	A6824-20ul
Manufacturer	Abclonal
Amount	20ul
Category	Oncology Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Antibodies By Cell Type Carcinoma Adenocarcinoma Western Blot Immunofluorescence Cardiovascular Research Heart Failure Myocardial Infarction Primary Antibodies By Organ Colorectal Cancer
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	PVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
NCBI	DCP1A
ECLASS 5.1	32160702
ECLASS 6.1	32160702
ECLASS 8.0	32160702
ECLASS 9.0	42030590
ECLASS 10.0.1	42030590
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	HSA275986, Nbla00360, SMAD4IP1, SMIF
Similar products	SMIF, HSA275986, Nbla00360, SMAD4IP1
Available
Background	Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants.
Route	Synthetic Peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 483-582 of human DCP1A (Q9NPI6).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	63kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling
Gene Symbol	DCP1A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ul

available

Delivery expected until 8/23/2024

Express Delivery: Save 11 days

Compare

Add to wishlist

Recommend by mail