« Back
Home /
MT-ND1 Rabbit pAb

MT-ND1 Rabbit pAb

Item no.	A5250-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNL
NCBI	mt-Ti
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	MTND1;ND1;NADH dehydrogenase subunit 1;NADH1;MT-ND1
Available
Background	Predicted to enable triplet codon-amino acid adaptor activity. Predicted to act upstream of or within translation. Predicted to be located in mitochondrion. Orthologous to human MT-TI (mitochondrially encoded tRNA-Ile (AUU/C)).
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse MT-ND1 (NP_904328.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	36kDa
Gene Symbol	mt-Ti

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail