« Back
Home /
Syntaxin 3 Rabbit mAb

Syntaxin 3 Rabbit mAb

Item no.	A3712-200ul
Manufacturer	Abclonal
Amount	200ul
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	KHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKD
NCBI	STX3
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	STX3A
Available
Background	The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle fusion and exocytosis. Alternative splicing results in multiple transcript variants.
Route	Synthetic Peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Syntaxin 3 (Q13277).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	33kDa
Manufacturers Research Area	Neuroscience, Cell Type Marker, Neuron marker, Synapse marker
Gene Symbol	STX3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ul

available

Delivery expected until 9/27/2024

Express Delivery: Save 23 days

Compare

Add to wishlist

Recommend by mail