Item no. |
A3564-1000uL |
Manufacturer |
Abclonal
|
Amount |
1000 uL |
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, IP, ELISA |
Specific against |
Human |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
LRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTS |
NCBI |
RNF2 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
BAP-1, BAP1, DING, HIPI3, RING1B, RING2 |
Available |
|
Background |
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. |
Route |
Synthetic Peptide |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RING1B/RNF2 (Q99496). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:2000|IP, 1:100 - 1:500 |
Protein Size |
38kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, Epigenetic writers and erasers of core Histones, Chromatin Remodeling |
Gene Symbol |
RNF2 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.