« Back
Home /
NHLH1 Rabbit mAb

NHLH1 Rabbit mAb

Item no.	A24828-20uL
Manufacturer	Abclonal
Amount	20 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQH
NCBI	NHLH1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	HEN1; NSCL; NSCL1; bHLHa35
Available
Background	The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).
Route	Recombinant Protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human NHLH1 (NP_005589.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IF/ICC, 1:50 - 1:200
Protein Size	15kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Neuroscience
Gene Symbol	NHLH1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 uL

available

Delivery expected until 8/23/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail