Comparison

ABflo® 488 Rabbit anti-Mouse CD44 mAb European Partner

Item no. A24636-200T
Manufacturer Abclonal
Amount 200 T
Category
Type Antibody Monoclonal
Applications FC
Specific against Mouse
Isotype IgG
Conjugate/Tag ABflo® 488. Ex:491nm. Em:516nm.
Purity Affinity purification
Sequence QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNI
NCBI Cd44
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Ly-24; Pgp-1; HERMES
Available
Background
Enables hyaluronic acid binding activity and type II transforming growth factor beta receptor binding activity. Contributes to cytokine binding activity and cytokine receptor activity. Involved in several processes, including negative regulation of T cell activation; positive regulation of protein phosphorylation; and regulation of intracellular signal transduction. Acts upstream of or within several processes, including Wnt signaling pathway; morphogenesis of a branching epithelium; and wound healing involved in inflammatory response. Located in basolateral plasma membrane; external side of plasma membrane; and microvillus. Part of macrophage migration inhibitory factor receptor complex. Is expressed in several structures, including alimentary system; branchial arch; central nervous system; genitourinary system; and limb. Human ortholog(s) of this gene implicated in breast carcinoma (multiple); carcinoma (multiple); and prostate cancer. Orthologous to human CD44 (CD44 molecule (Indian blood group)).
Route
Recombinant protein
Manufacturers Category
Monoclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 23-176 of mouse CD44 (NP_033981.2).
Storage
Store at 2-8℃. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution
FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size
85kDa
Manufacturers Research Area
Immunology, Cell Type Markers, CD, AdhesionStem , Cells Mesenchymal , Stem Cells , Surface Molecules, Cancer , Tumor immunology, CD markers, Cancer Tumor, biomarkers , Other, Stem Cells , Hematopoietic , Progenitors, Lymphoid , T Lymphocytic Lineage, Stem Cells , Hematopoietic Progenitors, Myeloid, Dendritic Cell Lineage, Stem Cells , Hematopoietic Progenitors , Myeloid , Neutrophil Lineage, Kits/ Lysates/ Other Kits , ELISA Kits, ELISA Kits, CD markers ELISA kits
Gene Symbol
Cd44

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 T
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close