Comparison

WT1 Rabbit mAb European Partner

Item no. A2446-200ul
Manufacturer Abclonal
Amount 200ul
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P
Specific against Human
Host Rabbit
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence PPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGV
NCBI WT1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias WT1; AWT1; EWS-WT1; GUD; NPHS4; WAGR; WIT-2; WT33; Wilms tumor 1
Available
Background
This gene encodes a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilms tumor. This gene exhibits complex tissue-specific and polymorphic imprinting pattern, with biallelic, and monoallelic expression from the maternal and paternal alleles in different tissues. Multiple transcript variants have been described. In several variants, there is evidence for the use of a non-AUG (CUG) translation initiation codon upstream of, and in-frame with the first AUG. Authors of PMID:7926762 also provide evidence that WT1 mRNA undergoes RNA editing in human and rat, and that this process is tissue-restricted and developmentally regulated.
Route
Recombinant protein
Manufacturers Category
Monoclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 60-250 of human WT1 (P19544).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200
Protein Size
49kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Cancer, Tumor biomarkers, Signal Transduction, ErbB-HER Signaling Pathway, Cell Biology Developmental Biology, Apoptosis
Gene Symbol
WT1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200ul
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close