« Back
Home /
ABflo® 647 Rabbit anti-Human CD270/HVEM mAb

ABflo® 647 Rabbit anti-Human CD270/HVEM mAb

Item no.	A24418-200T
Manufacturer	Abclonal
Amount	200 T
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	FC
Specific against	Human
Isotype	IgG
Conjugate/Tag	ABflo® 647. Ex:656nm. Em:670nm.
Purity	Affinity purification
Sequence	LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLC
NCBI	TNFRSF14
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	TNFRSF14; ATAR; CD270; HVEA; HVEM; LIGHTR; TR2; TNF receptor superfamily member 14
Available
Background	This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 39-162 of human CD270/HVEM(NP_003811.2)
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	21kDa/30kDa
Manufacturers Research Area	Cancer, Signal Transduction, Cell Biology & Developmental Biology, Apoptosis, Growth factor, TNF, Immunology & Inflammation, CD markers, Cytokines, TNF, NF-kB Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway,
Gene Symbol	TNFRSF14

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 T

available

Delivery expected until 9/27/2024

Express Delivery: Save 29 days

Compare

Add to wishlist

Recommend by mail