« Back
Home /
CD84 Rabbit mAb

CD84 Rabbit mAb

Item no.	A24338FB-200uL
Manufacturer	Abclonal
Amount	200 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	FC, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTG
NCBI	CD84
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	LY9B; hCD84; mCD84; SLAMF5
Available
Background	This gene encodes a membrane glycoprotein that is a member of the signaling lymphocyte activation molecule (SLAM) family. This family forms a subset of the larger CD2 cell-surface receptor Ig superfamily. The encoded protein is a homophilic adhesion molecule that is expressed in numerous immune cells types and is involved in regulating receptor-mediated signaling in those cells. Alternate splicing results in multiple transcript variants.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-225 of human CD84 (NP_001171808.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 50% glycerol, pH7.3.
Recommended Dilution	FC, 1:50 - 1:200
Protein Size	39kDa
Manufacturers Research Area	Immunology Inflammation, CDs, Stem Cells, Hematopoietic Progenitors
Gene Symbol	CD84

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 24 days

Compare

Add to wishlist

Recommend by mail