« Back
Home /
CD262/DR5/TRAILR2 Rabbit mAb,sodium and BSA azide free

CD262/DR5/TRAILR2 Rabbit mAb,sodium and BSA azide free

Item no.	A24254FB-50uL
Manufacturer	Abclonal
Amount	50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	FC, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE
NCBI	TNFRSF1B
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	TNFRSF10B; CD262; DR5; KILLER; KILLER/DR5; TRAIL-R2; TRAILR2; TRICK2; TRICK2A; TRICK2B; TRICKB; ZTNFR9; TNF receptor superfamily member 10b
Available
Background	The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 56-182 of human CD262 (NP_003833.4).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 50% glycerol, pH7.3.
Recommended Dilution	FC, 1:500 - 1:1000
Protein Size	12kDa/45kDa/47kDa
Manufacturers Research Area	Cancer, Signal Transduction, Cell Biology & Developmental Biology, Apoptosis, Growth factor, TNF, Death Receptor Signaling Pathway, Immunology & Inflammation, CD markers, NF-kB Signaling Pathway,
Gene Symbol	TNFRSF10B

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 24 days

Compare

Add to wishlist

Recommend by mail