« Back
Home /
PE Rabbit anti-Mouse ICOS/CD278 mAb

PE Rabbit anti-Mouse ICOS/CD278 mAb

Item no.	A24252-100T
Manufacturer	Abclonal
Amount	100 T
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	FC
Specific against	Mouse
Isotype	IgG
Conjugate/Tag	PE.Ex:480nm. Em:575nm
Purity	Affinity purification
Sequence	EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL
NCBI	Icos/CD278
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	H4; CCLP; AILIM; CRP-1; Ly115
Available
Background	Predicted to be involved in T cell costimulation; T cell tolerance induction; and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease; common variable immunodeficiency; and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to aminoacids 21-142 of Mouse ICOS/CD278(NP_059508.2).
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	22kDa
Manufacturers Research Area	Immunology Inflammation, CDs
Gene Symbol	Icos/CD278

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 T

available

Delivery expected until 9/27/2024

Express Delivery: Save 17 days

Compare

Add to wishlist

Recommend by mail