Comparison

UTX(Kdm6a) Rabbit pAb European Partner

Item no. A24048-200uL
Manufacturer Abclonal
Amount 200 uL
Category
Type Antibody Polyclonal
Applications WB
Specific against Mouse
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence DSSLPTNSVSGQQPQLPLTRMPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTEEPWKNQLSNSTQGLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNTLTVPETSRQTGETPNSTASVEGLPNHVHQVMADAVCSPSHGDSKSPGLLSSDNPQL
NCBI Kdm6a
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias Kdm6a
Available
Background
The methylation status of histone lysine residues is a major determinant of the formation of both activated and inactive regions of the genome, and plays a crucial role in the correct programming of the genome during development. Proteins containing the Jumonji C (JmjC) domain represent the largest category of potential histone demethylase proteins. The JmjC domain can be achieved through iron ions and α- The oxidation reaction of ketoglutaric acid catalyzes the demethylation of single, double, and trimethyllysine residues. Based on homology, both humans and mice contain at least 30 such proteins, which can be divided into 7 different families. The three members of the UTX/UTY family include the widely transcribed X chromosome 34 peptide repeat protein (UTX), the widely transcribed Y chromosome 34 peptide repeat protein (UTY), and the protein 3 containing the JmjC domain (JMJD3). This protein family can demethylate the histones H3 Lys 27 of both dimethyl and trimethyl histones. In women, the UTX gene can escape X chromosome inactivation and is widely expressed. During development, UTX can regulate HOX gene expression. JMJD3 regulates gene expression in macrophages under different inflammatory stimuli and is upregulated in prostate cancer. UTX and JMJD3 both interact with mixed lineage leukemia (MLL) complexes 2 and 3, which can methylate histone H3 at the Lys4 site. The UTY gene is expressed in most tissues of male mice.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 530-780 of mouse UTX.
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000
Manufacturers Research Area
Chromatin regulator, dioxygenase, oxidoreductase
Gene Symbol
Kdm6a

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close