« Back
Home /
CD71/Transferrin Receptor mAb

CD71/Transferrin Receptor mAb

Item no.	A24047-20uL
Manufacturer	Abclonal
Amount	20 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human
Isotype	IgG
Purity	Affinity purification
Sequence	RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV
NCBI	TFRC
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Available
Background	This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71/Transferrin Receptor (NP_003225.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Size	85kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, RNA Binding, Cancer, Endocrine Metabolism, Immunology Inflammation, CDs, Stem Cells, Hematopoietic Progenitors, Neural Stem Cells, Cardiovascular, Blood, Serum Proteins, Hypoxia
Gene Symbol	TFRC

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 17 days

Compare

Add to wishlist

Recommend by mail