Comparison

ABflo® 594 Rabbit anti-Mouse CD5 mAb European Partner

Item no. A23973-200T
Manufacturer Abclonal
Amount 200 T
Category
Type Antibody Monoclonal
Applications FC
Specific against Mouse
Isotype IgG
Conjugate/Tag ABflo® 594. Ex:594nm. Em:619nm.
Purity Affinity purification
Sequence SGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLV
NCBI Cd5
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias Ly-1; Ly-A; Ly-12; Lyt-1
Available
Background
CD5 is a type I transmembrane protein belonging to the scavenger receptor cysteine-enriched (SRCR) family, characterized by the presence of at least one SRCR domain containing 90-110 amino acids. CD5 is expressed in all mature T cells, B-1A subsets of mature B cells, and certain leukemia B cells. It is elevated in regulatory T and B cells (Tregs/Bregs). CD5 expression was also elevated in incompetent T and B cells. Elevated levels of CD5 have also been found in many autoimmune diseases. CD5 binds to T cell receptors (TCR) and negatively regulates T cell activation and differentiation. The expression of CD5 in tumor-infiltrating T lymphocytes was negatively correlated with their antitumor activity. Recently, it has been reported that CD5 binds directly to IL6 and mediates downstream signal transduction. CD5+ B cells promote tumor growth in animal models. Agents targeting CD5 are being actively explored as therapeutic interventions for cancer and other conditions.
Route
Recombinant protein
Manufacturers Category
Monoclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-371 of mouse CD5 (NP_031676.3).
Storage
Store at 2-8℃. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution
FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size
54kDa
Manufacturers Research Area
Immunology; Adaptive Immunity; B Cells; CD; Immunology; Adaptive Immunity; T Cells; CD; Stem Cells; Hematopoietic Progenitors; Lymphoid; B Lymphocytic Lineage; ; Hematopoietic Progenitors; Lymphoid; T Lymphocytic Lineage
Gene Symbol
Cd5

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 T
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close