« Back
Home /
ABflo® 594 Rabbit anti-Mouse CD201/EPCR mAb

ABflo® 594 Rabbit anti-Mouse CD201/EPCR mAb

Item no.	A23970-200T
Manufacturer	Abclonal
Amount	200 T
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	FC
Specific against	Mouse
Isotype	IgG
Conjugate/Tag	ABflo® 594. Ex:594nm. Em:619nm.
Purity	Affinity purification
Sequence	LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGR
NCBI	Procr
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	Ccca; Epcr; Ccd41
Available
Background	Predicted to enable protein C-terminus binding activity. Predicted to be involved in negative regulation of coagulation. Predicted to act upstream of or within blood coagulation. Located in centrosome. Is expressed in several structures, including blastocyst; endocardial tissue; female reproductive system; liver; and vascular element. Orthologous to human PROCR (protein C receptor).
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-210 of mouse CD201/EPCR(NP_035301.2).
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	27kDa
Manufacturers Research Area	Cardiovascular Blood Coagulation RegulatoryStem Cells Hematopoietic Progenitors Intracellular MoleculesCardiovascular Vasculature EndotheliumCardiovascular Angiogenesis Endothelial Cell Markers
Gene Symbol	Procr

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 T

available

Delivery expected until 9/27/2024

Express Delivery: Save 29 days

Compare

Add to wishlist

Recommend by mail