Comparison

LIM kinase 1(LIMK1) Rabbit mAb European Partner

Item no. A23948-200uL
Manufacturer Abclonal
Amount 200 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P
Specific against Human
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence NADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
NCBI LIMK1
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias LIMK1; LIMK; LIMK-1; LIM domain kinase 1
Available
Background
There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is a serine/threonine kinase that regulates actin polymerization via phosphorylation and inactivation of the actin binding factor cofilin. This protein is ubiquitously expressed during development and plays a role in many cellular processes associated with cytoskeletal structure. This protein also stimulates axon growth and may play a role in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Route
Synthetic peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 630-647 of human LIM kinase 1(LIMK1)(NP_002305.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:1000 - 1:5000|IHC-P, 1:50 - 1:200
Protein Size
33kDa/68kDa/70kDa/72kDa
Manufacturers Research Area
Signal Transduction, Kinase, Serine/threonine kinases, Tyrosine kinases, Cell Biology & Developmental Biology, Cytoskeleton, Microfilaments, Microtubules, Actins, TGF-b-Smad Signaling Pathway, Immunology & Inflammation, Neuroscience, Cell Type Marker, Neuron marker, Growth Cone,
Gene Symbol
LIMK1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close