Item no. |
A23297-100uL |
Manufacturer |
Abclonal
|
Amount |
100 uL |
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, FC, IP, ELISA |
Specific against |
Human |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
NKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNAT |
NCBI |
DPP4 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
CD26; ADABP; ADCP2; DPPIV; TP103 |
Available |
|
Background |
The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Dipeptidyl peptidase 4 is highly involved in glucose and insulin metabolism, as well as in immune regulation. This protein was shown to be a functional receptor for Middle East respiratory syndrome coronavirus (MERS-CoV), and protein modeling suggests that it may play a similar role with SARS-CoV-2, the virus responsible for COVID-19. |
Route |
Recombinant protein |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 29-766 of human CD26/DPP4(NP_001926.2) |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:1000 - 1:5000|IP, 1:100 - 1:500|FC, 1:50 - 1:200 |
Protein Size |
88kDa |
Manufacturers Research Area |
Cancer, Cell Biology Developmental Biology, Ubiquitin, Endocrine Metabolism, Immunology Inflammation, CDs, Stem Cells, Hematopoietic Progenitors |
Gene Symbol |
DPP4 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.