« Back
Home /
Nlrp6 Rabbit pAb

Nlrp6 Rabbit pAb

Item no.	A23267-200uL
Manufacturer	Abclonal
Amount	200 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	RQHAKVKERNARSVKINKRFTKLLIAPGTGAVEDELLGPLGEPEPERARRSDTHTFNRLFRGNDEESSQPLTVVLQGPAGIGKTMAAKKILYDWAAGKLYHSQVDFAFFMPCGE
NCBI	Nlrp6
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Avr; Navr; Nalp6; Pypaf5; Non-AVR; Navr/Avr
Available
Background	The protein encoded by this gene binds arginine-vasopressin and may be involved in the arginine-vasopressin-mediated regulation of renal salt-water balance. The encoded protein also mediates inflammatory responses in the colon to allow recovery from intestinal epithelial damage and protects against tumorigenesis and the development of colitis. Finally, this protein can increase activation of NF-kappa-B, activation of CASP1 through interaction with ASC, and cAMP accumulation.
Route	Synthetic Peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 124-237 of mouse Nlrp6(NP_598707.2 ).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	97kDa
Gene Symbol	Nlrp6

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail