« Back
Home /
PI3 Kinase p85 alpha/beta/gamma mAb

PI3 Kinase p85 alpha/beta/gamma mAb

Item no.	A22996-50uL
Manufacturer	Abclonal
Amount	50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IF, ICC, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	SVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQT
NCBI	PIK3R1/PIK3R2/PIK3R3
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	PIK3R1/PIK3R2/PIK3R3
Available
Background	Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms. [provided by RefSeq, Jun 2011]
Route	Synthetic peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 400-500 of human PI3 Kinase p85 alpha/beta (NP_852664.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:2000 - 1:10000\|IF/ICC, 1:50 - 1:200
Protein Size	42-54kDa/81-84kDa
Manufacturers Research Area	Protein phosphorylation
Gene Symbol	PIK3R1/PIK3R2/PIK3R3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 32 days

Compare

Add to wishlist

Recommend by mail