Item no. |
A22863-50uL |
Manufacturer |
Abclonal
|
Amount |
50 uL |
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, ELISA, IHC-P, Dot |
Specific against |
Human |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
NCBI |
Histone H3 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A |
Available |
|
Background |
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. |
Route |
Synthetic peptide |
Manufacturers Category |
Methylated Antibodies |
Immunogen |
A synthetic monomethylated peptide around K36 of human histone H3(NP_003520.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
DB, 1:500 - 1:1000|WB, 1:500 - 1:1000|IHC-P, 1:500 - 1:1000 |
Protein Size |
15kDa |
Manufacturers Research Area |
Protein phosphorylation, Signal Transduction, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Cell Cycle, Immunology Inflammation, NF-kB Signaling Pathway, Epigenetics & Nuclear Signaling, Epigenetic Modifications, Methylation |
Gene Symbol |
Histone H3 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.