Comparison

ABflo® 488 Rabbit anti-Human CD59 mAb European Partner

Item no. A22588-500T
Manufacturer Abclonal
Amount 500 T
Category
Type Antibody Monoclonal
Applications FC
Specific against Human
Isotype IgG
Conjugate/Tag ABflo® 488. Ex:491nm. Em:516nm.
Purity Affinity purification
Sequence LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLE
NCBI CD59
ECLASS 5.1 32160702
ECLASS 6.1 32160702
ECLASS 8.0 32160702
ECLASS 9.0 42030590
ECLASS 10.0.1 42030590
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20
Available
Background
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene.
Route
Recombinant protein
Manufacturers Category
Monoclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 26-101 of human CD59 (NP_000602.1).
Storage
Store at 2-8℃. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution
FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size
14kDa
Manufacturers Research Area
Signal Transduction, Kinase, Tyrosine kinases, Immunology Inflammation, CDs, Cell Intrinsic Innate Immunity Signaling Pathway, Stem Cells, Hematopoietic Progenitors, Cardiovascular
Gene Symbol
CD59

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 T
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close