Item no. |
A22588-500T |
Manufacturer |
Abclonal
|
Amount |
500 T |
Category |
|
Type |
Antibody Monoclonal |
Applications |
FC |
Specific against |
Human |
Isotype |
IgG |
Conjugate/Tag |
ABflo® 488. Ex:491nm. Em:516nm. |
Purity |
Affinity purification |
Sequence |
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLE |
NCBI |
CD59 |
ECLASS 5.1 |
32160702 |
ECLASS 6.1 |
32160702 |
ECLASS 8.0 |
32160702 |
ECLASS 9.0 |
42030590 |
ECLASS 10.0.1 |
42030590 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20 |
Available |
|
Background |
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. |
Route |
Recombinant protein |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 26-101 of human CD59 (NP_000602.1). |
Storage |
Store at 2-8℃. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Recommended Dilution |
FC, 5 μl per 10^6 cells in 100 μl volume |
Protein Size |
14kDa |
Manufacturers Research Area |
Signal Transduction, Kinase, Tyrosine kinases, Immunology Inflammation, CDs, Cell Intrinsic Innate Immunity Signaling Pathway, Stem Cells, Hematopoietic Progenitors, Cardiovascular |
Gene Symbol |
CD59 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.