Comparison

Cleaved PARP (Asp214) Rabbit pAb European Partner

Item no. A22535-50uL
Manufacturer Abclonal
Amount 50 uL
Category
Type Antibody Polyclonal
Applications WB, ELISA
Specific against Mouse
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence AIKNEGKRKGDEVDGTDEVAKKKSKKGKDKDSSKLEKALKAQNELIWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS
NCBI Parp1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias PARP; PPOL; ARTD1; Adprp; Adprt1; msPARP; parp-1; sPARP-1; 5830444G22Rik
Available
Background
Enables NAD+ ADP-ribosyltransferase activity; chromatin binding activity; and protein ADP-ribosylase activity. Involved in negative regulation of telomere maintenance via telomere lengthening; positive regulation of single strand break repair; and voluntary musculoskeletal movement. Acts upstream of or within several processes, including DNA metabolic process; behavioral response to cocaine; and protein poly-ADP-ribosylation. Located in cytoplasm; nucleolus; and nucleoplasm. Part of protein-containing complex. Is expressed in several structures, including Peyer's patch; brain; gut; immune system; and retina. Human ortholog(s) of this gene implicated in several diseases, including arthritis; bacterial meningitis; neurodegenerative disease (multiple); stomach carcinoma; and type 2 diabetes mellitus. Orthologous to human PARP1 (poly(ADP-ribose) polymerase 1).
Route
Synthetic peptide
Manufacturers Category
Polyclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 201-300 of Mouse PARP (Asp214) (NP_031441.2).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:100 - 1:500
Protein Size
113kDa
Manufacturers Research Area
Epigenetics & Nuclear Signaling, Chromatin Modifying Enzymes, other, DNA Damage & Repair, RNA Binding, Signal Transduction, Cell Biology & Developmental Biology, Cell Cycle, Centrosome, Death Receptor Signaling Pathway, Immunology & Inflammation, NF-kB Signaling Pathway
Gene Symbol
Parp1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close