« Back
Home /
Clusterin alpha chain Rabbit mAb

Clusterin alpha chain Rabbit mAb

Item no.	A22325-50uL
Manufacturer	Abclonal
Amount	50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	STNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
NCBI	CLU
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2
Available
Background	The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 314-449 of human Clusterin alpha chain (NP_001822.3).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	52kDa
Manufacturers Research Area	Cancer, Tumor biomarkers, Signal Transduction, Cell Biology Developmental Biology, Apoptosis, Endocrine Metabolism, Lipid Metabolism, Immunology Inflammation, Cell Intrinsic Innate Immunity Signaling Pathway, Cardiovascular, Lipids
Gene Symbol	CLU

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 16 days

Compare

Add to wishlist

Recommend by mail