« Back
Home /
ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb

ABflo® 488 Rabbit anti-Human/Monkey CD20 mAb

Item no.	A22152-500T
Manufacturer	Abclonal
Amount	500 T
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	FC
Specific against	Human
Isotype	IgG
Conjugate/Tag	ABflo® 488. Ex:491nm. Em:516nm.
Purity	Affinity purification
Sequence	LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF
NCBI	MS4A1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16
Available
Background	This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.
Route	Synthetic peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 mAb (NP_068769.2).
Storage	Store at 2-8℃. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Recommended Dilution	FC, 5 μl per 10^6 cells in 100 μl volume
Protein Size	14kDa/33kDa
Manufacturers Research Area	Cancer, Tumor immunology, Tumor-associated antigens, Immunology Inflammation, CDs, Stem Cells, Hematopoietic Progenitors
Gene Symbol	MS4A1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 T

available

Delivery expected until 8/23/2024

Express Delivery: Save 2 days

Compare

Add to wishlist

Recommend by mail