« Back
Home /
POLR2A Rabbit mAb

POLR2A Rabbit mAb

Item no.	A21980-50uL
Manufacturer	Abclonal
Amount	50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IP, ELISA, CHIP
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	KRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAG
NCBI	POLR2A
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	POLR2A;POLR2;POLRA;RPB1;RPBh1;RPO2;RPOL2;RpIILS;hRPB220;hsRPB1;Pol II
Available
Background	This gene encodes the largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a carboxy terminal domain composed of heptapeptide repeats that are essential for polymerase activity. These repeats contain serine and threonine residues that are phosphorylated in actively transcribing RNA polymerase. In addition, this subunit, in combination with several other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA.
Route	Synthetic peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 550-650 of human POLR2A POLR2A (N-terminal) (NP_000928.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:1000 - 1:5000\|IP, 1:1000 - 1:5000\|ChIP, 1:1000 - 1:5000
Protein Size	217kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, DNA Damage Repair, Protein phosphorylation, Neuroscience, Neurodegenerative Diseases
Gene Symbol	POLR2A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 8/23/2024

Express Delivery: Save 2 days

Compare

Add to wishlist

Recommend by mail