Item no. |
A21944-200T |
Manufacturer |
Abclonal
|
Amount |
200 T |
Category |
|
Type |
Antibody Monoclonal |
Applications |
FC |
Specific against |
Human |
Isotype |
IgG |
Conjugate/Tag |
ABflo® 488. Ex:491nm. Em:516nm. |
Purity |
Affinity purification |
Sequence |
KAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLIRIWARPSAIAAGHGDYALNVTGP |
NCBI |
ANPEP |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
APN; AP-M; AP-N; CD13; LAP1; P150; PEPN; hAPN; GP150 |
Available |
|
Background |
Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. This membrane-bound zinc metalloprotease is known to serve as a receptor for the HCoV-229E alphacoronavirus as well as other non-human coronaviruses. This gene has also been shown to promote angiogenesis, tumor growth, and metastasis and defects in this gene are associated with various types of leukemia and lymphoma. |
Route |
Recombinant protein |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 69-967 of human CD13/ANPEP (NP_001141.2). |
Storage |
Store at 2-8℃. Avoid freeze.|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Recommended Dilution |
FC, 5 μl per 10^6 cells in 100 μl volume |
Protein Size |
110kDa |
Manufacturers Research Area |
Immunology Inflammation, CDs, Stem Cells, Hematopoietic Progenitors, Mesenchymal Stem Cells, Cardiovascular, Angiogenesis |
Gene Symbol |
ANPEP |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.