« Back
Home /
L3MBTL3 Rabbit mAb

L3MBTL3 Rabbit mAb

Item no.	A21932-500uL
Manufacturer	Abclonal
Amount	500 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IP, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATATTTWMVPTAQEAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLKADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPPKGKKAWCWASYLEEEKAVAVPAKLFKEHQ
NCBI	L3MBTL3
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	L3MBTL3;MBT-1;MBT1
Available
Background	This gene encodes a member of the malignant brain tumor (MBT) family of chromatin interacting transcriptional repressors. Members of this family function as methyl-lysine readers, which recognize methylated lysine residues on histone protein tails, and are associated with the repression of gene expression. The encoded protein may regulate hematopoiesis. Homozygous deletion of this gene has been observed in human patients with medulloblastoma.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human L3MBTL3 (NP_115814.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:2000 - 1:20000\|IP, 150 - 1:200
Protein Size	88kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Chromatin Remodeling, Stem Cells, Hematopoietic Progenitors
Gene Symbol	L3MBTL3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 17 days

Compare

Add to wishlist

Recommend by mail