Comparison

DDIT3/CHOP Rabbit mAb European Partner

Item no. A21900-500uL
Manufacturer Abclonal
Amount 500 uL
Category
Type Antibody Monoclonal
Applications WB, ELISA, IHC-P
Specific against Human
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQG
NCBI DDIT3
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CHOP; CEBPZ; CHOP10; CHOP-10; GADD153; AltDDIT3; C/EBPzeta
Available
Background
This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.
Route
Synthetic peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDIT3/CHOP (NP_004074.2).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200
Protein Size
19kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Signal Transduction, Cell Biology Developmental Biology, Autophagy, Endocrine Metabolism, Endocrine and metabolic diseases, Diabetes, Obesity, Stem Cells, Embryonic Stem Cells
Gene Symbol
DDIT3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close