Comparison

NR1I3 Rabbit pAb European Partner

Item no. A21765-1000uL
Manufacturer Abclonal
Amount 1000 uL
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA
Specific against Human
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence PVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDGARVSPTVGFQVEFLELLFHFHGTLRKLQLQEPEYVLLAAMALFSPDRPGVTQRDEIDQLQEEMALTLQSYIKGQQRRPRDRFLYAKLLGLLAELRSINEAYGYQIQHIQGLSAMMPLLQEICS
NCBI NR1I3
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias CAR; CAR1; MB67
Available
Background
This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. In addition to drug metabolism, the CAR protein is also reported to regulate genes involved in glucose metabolism, lipid metabolism, cell proliferation, and circadian clock regulation. Multiple transcript variants encoding different isoforms have been found for this gene.
Route
Recombinant protein
Manufacturers Category
Polyclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 103-352 of human NR1I3 (NP_001070948.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200
Protein Size
40kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Nuclear Receptor Signaling, Cancer, Signal Transduction, Endocrine Metabolism, Drug metabolism
Gene Symbol
NR1I3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1000 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close