Comparison

[KO Validated] SUMO1 Rabbit pAb European Partner

Item no. A21643-500uL
Manufacturer Abclonal
Amount 500 uL
Category
Type Antibody Polyclonal
Applications WB, IF, ICC, ELISA, IHC-P
Specific against Human
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHST
NCBI SUMO1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3
Available
Background
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized.
Route
Synthetic peptide
Manufacturers Category
Polyclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SUMO1 (NP_003343.1).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:100|IF/ICC, 1:50 - 1:200
Protein Size
12kDa
Manufacturers Research Area
Epigenetics Nuclear Signaling, RNA Binding, Cell Biology Developmental Biology, Autophagy, Ubiquitin, Endocrine Metabolism, Mitochondrial metabolism, Immunology Inflammation, Jak-Stat-IL-6 Receptor Signaling Pathway, NF-kB Signaling Pathway, Cardiovascular, Heart
Gene Symbol
SUMO1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close