Item no. |
A21326-50uL |
Manufacturer |
Abclonal
|
Amount |
50 uL |
Category |
|
Type |
Antibody Polyclonal |
Applications |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
NCBI |
CDKN2C |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
p18; INK4C; p18-INK4C |
Available |
|
Background |
The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported. |
Route |
Recombinant protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-168 of human CDKN2C/p18-INK4C (NP_523240.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200 |
Protein Size |
18kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, Cancer, Tumor suppressors, Signal Transduction, Kinase, Serine threonine kinases, Cell Biology Developmental Biology, Cell Cycle, Cell cycle inhibitors, Cell Cycle Control-G1 S Checkpoint |
Gene Symbol |
CDKN2C |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.