Comparison

RAB8A Rabbit mAb European Partner

Item no. A20976-20uL
Manufacturer Abclonal
Amount 20 uL
Category
Type Antibody Monoclonal
Applications WB, IF, IP, ICC, ELISA
Specific against Human
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence RNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
NCBI RAB8A
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias RAB8A;MEL;RAB8
Available
Background
The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1.
Route
Synthetic peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-207 of human RAB8A (P61006).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IF/ICC, 1:50 - 1:200|IP, 1:50 - 1:200
Protein Size
24kDa
Manufacturers Research Area
Signal Transduction, G protein signaling, Small G proteins, Cell Biology Developmental Biology, Cell Cycle, Centrosome
Gene Symbol
RAB8A

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close