« Back
Home /
[KD Validated] IRAK4 Rabbit mAb

[KD Validated] IRAK4 Rabbit mAb

Item no.	A20839-50uL
Manufacturer	Abclonal
Amount	50 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV
NCBI	IRAK4
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	IPD1; IMD67; REN64; IRAK-4; NY-REN-64
Available
Background	This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human IRAK4 (NP_057207.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	52kDa
Manufacturers Research Area	Signal Transduction, Kinase, Serine threonine kinases, Immunology Inflammation, Cytokines, Interleukins, NF-kB Signaling Pathway, Toll-like Receptor Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, TLR Signaling, Cardiovascular
Gene Symbol	IRAK4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50 uL

available

Delivery expected until 8/23/2024

Express Delivery: Save 3 days

Compare

Add to wishlist

Recommend by mail