« Back
Home /
NREP Rabbit pAb

NREP Rabbit pAb

Item no.	A20437-500uL
Manufacturer	Abclonal
Amount	500 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF
NCBI	NREP
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P311; PTZ17; SEZ17; D4S114; C5orf13; PRO1873
Available
Background	Predicted to be involved in axon regeneration; regulation of neuron differentiation; and regulation of transforming growth factor beta receptor signaling pathway. Predicted to be active in cytoplasm and nucleus.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human NREP (NP_004763.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	8kDa
Manufacturers Research Area	Signal Transduction, Cell Biology Developmental Biology, Cell Cycle, Cell differentiation, Endocrine Metabolism, Lipid Metabolism, Neuroscience, Cardiovascular, Lipids
Gene Symbol	NREP

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 30 days

Compare

Add to wishlist

Recommend by mail