« Back
Home /
Cdkl4 Rabbit pAb

Cdkl4 Rabbit pAb

Item no.	A20290-1000uL
Manufacturer	Abclonal
Amount	1000 uL
Category	Antibodies Primary Antibodies
Type	Antibody Polyclonal
Applications	WB, ELISA
Specific against	Mouse
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	KLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSNVQPVALSFMKGCLKMNPDERLTCAQLLDSAYFESFQEDQMKRKARSEGRSRRRQQNQLLPLIPGSHISPTPDGRKQVVQLKFDHLPNI
NCBI	Cdkl4
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	Gm942
Available
Background	Predicted to enable cyclin-dependent protein serine/threonine kinase activity. Predicted to be involved in protein phosphorylation. Predicted to act upstream of or within phosphorylation. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Is expressed in several structures, including alimentary system; central nervous system; reproductive system; respiratory system; and skeleton. Orthologous to human CDKL4 (cyclin dependent kinase like 4).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 219-342 of mouse Cdkl4。 (NP_001028615.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:1500 - 1:5000
Protein Size	39kDa
Gene Symbol	Cdkl4

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1000 uL

available

Delivery expected until 8/23/2024

Express Delivery: Save 1 days

Compare

Add to wishlist

Recommend by mail