Comparison

CD3E+CD3G Rabbit mAb European Partner

Item no. A20213-500uL
Manufacturer Abclonal
Amount 500 uL
Category
Type Antibody Monoclonal
Applications WB, FC, ELISA
Specific against Human
Isotype IgG
Conjugate/Tag Unconjugated
Purity Affinity purification
Sequence MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI(CD3E)&MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGS
NCBI CD3(epsilon+gamma)/CD3E+CD3G
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias CD3E;IMD18;T3E;TCRE;CD3e molecule;CD3G;CD3-GAMMA;IMD17;T3G
Available
Background
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.
Route
Recombinant protein
Manufacturers Category
Monoclonal Antibodies
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-207(CD3E)& 1-182(CD3G) of human CD3 epsilon&CD3 gamma Heterodimer.
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:1000 - 1:5000|FC, 1:500 - 1:1000
Protein Size
23kDa
Manufacturers Research Area
Cell Biology & Developmental Biology, Apoptosis, Immunology & Inflammation, CD markers, T Cell Receptor Signaling Pathway, Stem Cells, Hematopoietic Progenitors, Cell Biology & Developmental Biology, Apoptosis, Immunology & Inflammation, CD markers, T Cell Receptor Signaling Pathway
Gene Symbol
CD3(epsilon+gamma)/CD3E+CD3G

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 uL
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close