Item no. |
A20213-500uL |
Manufacturer |
Abclonal
|
Amount |
500 uL |
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, FC, ELISA |
Specific against |
Human |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI(CD3E)&MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGS |
NCBI |
CD3(epsilon+gamma)/CD3E+CD3G |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
CD3E;IMD18;T3E;TCRE;CD3e molecule;CD3G;CD3-GAMMA;IMD17;T3G |
Available |
|
Background |
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. |
Route |
Recombinant protein |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-207(CD3E)& 1-182(CD3G) of human CD3 epsilon&CD3 gamma Heterodimer. |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:1000 - 1:5000|FC, 1:500 - 1:1000 |
Protein Size |
23kDa |
Manufacturers Research Area |
Cell Biology & Developmental Biology, Apoptosis, Immunology & Inflammation, CD markers, T Cell Receptor Signaling Pathway, Stem Cells, Hematopoietic Progenitors, Cell Biology & Developmental Biology, Apoptosis, Immunology & Inflammation, CD markers, T Cell Receptor Signaling Pathway |
Gene Symbol |
CD3(epsilon+gamma)/CD3E+CD3G |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.