Item no. |
A19645-100ul |
Manufacturer |
Abclonal
|
Amount |
100ul |
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, ELISA, Dot |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY |
NCBI |
Histone H3 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
H3/A;H3C2;H3C3;H3C4;H3C6;H3C7;H3C8;H3FA;H3C10;H3C11;H3C12;HIST1H3A |
Similar products |
HIST1H3A, H3FA, H3C2, H3/A, H3C3, H3C4, H3C6, H3C7, H3C8, H3C10, H3C11, H3C12 |
Available |
|
Background |
This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. |
Route |
Synthetic Peptide |
Manufacturers Category |
Methylated Antibodies |
Immunogen |
A synthetic monomethylated peptide around R2 of human Histone H3 (Q16695). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
DB, 1:500 - 1:1000|WB, 1:500 - 1:1000|CUT&Tag, 10⁵ cells /1 μg |
Protein Size |
16kDa |
Gene Symbol |
Histone H3 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.