« Back
Home /
RIPK1/RIP Rabbit mAb

RIPK1/RIP Rabbit mAb

Item no.	A19580-20ul
Manufacturer	Abclonal
Amount	20ul
Category	Antibodies Cell Biology Cell Status Apoptosis Western Blot Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, IP, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	YLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWY
NCBI	RIPK1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	RIP;RIP-1;RIP1;RIPK1
Similar products	RIPK1, RIP, RIP1, RIP-1
Available
Background	This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of developmental regulation. RIPK1/RIPK3 kinase-mediated necrosis is referred to as necroptosis. Genetic disruption of this gene in mice results in death shortly after birth.
Route	Recombinant protein
Manufacturers Category	Monoclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 289-490 of human RIPK1/RIP (NP_003795.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IP, 1:100 - 1:500
Protein Size	76kDa
Manufacturers Research Area	Cancer, Invasion and Metastasis, Signal Transduction, Kinase, Serine threonine kinases, MAPK-JNK Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Inhibition of Apoptosis, Death Receptor Signaling Pathway, Immunology Inflammation, NF-kB Signaling Pathway, Toll-like Receptor Signaling Pathway
Gene Symbol	RIPK1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ul

available

Delivery expected until 8/23/2024