Item no. |
A19230-50ul |
Manufacturer |
Abclonal
|
Amount |
50ul |
Category |
|
Type |
Antibody Monoclonal |
Applications |
WB, ELISA |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Conjugate/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
NLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYV |
NCBI |
LGI1 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
LGI1; ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099; leucine rich glioma inactivated 1 |
Similar products |
LGI1, EPITEMPIN, EPT, ETL1, IB1099, ADLTE, ADPAEF, ADPEAF, leucine rich glioma inactivated 1 |
Available |
|
Background |
This gene encodes a member of the secreted leucine-rich repeat (LRR) superfamily and shares homology with members of the SLIT protein family. The encoded protein may regulate the activity of voltage-gated potassium channels and may be involved in neuronal growth regulation and cell survival. This gene is rearranged as a result of translocations in glioblastoma cell lines, and it is frequently down-regulated or rearranged in malignant gliomas. Mutations in this gene result in autosomal dominant lateral temporal epilepsy. Alternative splicing results in multiple transcript variants. |
Route |
Synthetic peptide |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LGI1 (O95970). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000 |
Protein Size |
64kDa |
Manufacturers Research Area |
Epigenetics Nuclear Signaling, Cancer, Tumor suppressors, Cell Biology Developmental Biology, Wnt/β-Catenin Signaling Pathway, Neuroscience, Neurodegenerative Diseases |
Gene Symbol |
LGI1 |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.