« Back
Home /
Glucosylceramidase beta (GBA) Rabbit mAb

Glucosylceramidase beta (GBA) Rabbit mAb

Item no.	A19057-500uL
Manufacturer	Abclonal
Amount	500 uL
Category	Antibodies Primary Antibodies
Type	Antibody Monoclonal
Applications	WB, ELISA, IHC-P
Specific against	Human
Isotype	IgG
Conjugate/Tag	Unconjugated
Purity	Affinity purification
Sequence	VDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ
NCBI	GBA1
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	GBA;GBA1;GCB;GLUC
Available
Background	This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
Route	Synthetic Peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase beta (GBA) (P04062).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	60kDa
Manufacturers Research Area	Cancer, Signal Transduction, Endocrine Metabolism, Lipid Metabolism, Neuroscience, Cell Type Marker, Neurodegenerative Diseases, Dopamine Signaling in Parkinson's Disease
Gene Symbol	GBA1

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500 uL

available

Delivery expected until 9/27/2024

Express Delivery: Save 16 days

Compare

Add to wishlist

Recommend by mail